Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Synthesis and Degradation » AKR Antibodies » AKR7A Antibody (H-300): sc-32944

AKR7A Antibody (H-300): sc-32944

 |  Datasheet

(Based on data analysis)

  • AKR7A Antibody (H-300) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 63-359 mapping at the C-terminus of AKR7A2 of human origin
  • recommended for detection of AKR7A2, AKR7A3 and AKR7A4 of human origin, AKR7A5 of mouse origin and AKR7A2 of rat origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
  • See 1 citations for AKR7A Antibody (H-300)
 
Full-length AKR7A protein sequence with immunogen highlighted:
MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR

See additional AKR Antibodies including AKR, AKR1B8, AKR1C12, AKR1C18, AKR1C20, AKR1C21, AKR1C6, AKR7A3, AKR7A4, AKR7A5, AKR7A, AKR1A1, AKR1CL1, AKR1D1, AKR1E1, AKR1CL2, AKR1B7, AKR7A2, AKR1B10, AKR1C13, AKR1C14 and AKR1C19.

Also see AKR Inhibitors for functional analysis of cellular responses to AKR.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
AKR7A Antibody (H-300) sc-32944 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AKR7A5 siRNA (m) sc-140994 10 µM $258
AKR7A5 (m)-PR sc-140994-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AKR7A5 shRNA Plasmid (m) sc-140994-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AKR7A5 shRNA (m) Lentiviral Particles sc-140994-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AKR7A3 (h2): 293T Lysate sc-114111 100 µg/200 µl $205
HL-60 Whole Cell Lysate sc-2209 500 µg/200 µl $104
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
AKR7 (h2): 293T Lysate sc-173982 100 µg/200 µl $205
AKR7 (h): 293T Lysate sc-173942 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human AKR7A2 8574 1p36.13 NM_003689 O43488
 603418
Human AKR7A3 22977 1p36.13 NM_012067 O95154
 608477
Mouse Akr7a5 110198 4 D3 Q8CG76
 N/A
 

The aldo-keto reductase 7 (AKR7) family includes AKR7A2, AKR7A3 and AKR7A4 in human, AKR7A5 in mouse and AKR7A2 in rat, all of which function in the metabolism of Aflatoxin B1 and other dicarbonyl-containing compounds. More specifically, AKR7A proteins are involved in the metabolism of compounds with ketone groups on adjacent carbon atoms in a broad range of tissues, notably the liver. The human AKR7A2 gene maps to human chromosome 1p36.13, a region frequently deleted in sporadic colorectal cancer. The functional significance of this correlation lies in the constitutive expression of AKR7A2 in human liver to eliminate Aflatoxin (an environmental carcinogen), thus acting as an endogenous chemo-preventative agent. AKR7A3 is believed to be a homodimer expressed in kidney, colon, pancreas, endometrium and adenocarcinoma.

AKR7A Antibody (H-300) Product Citations
See how others have used AKR7A Antibody (H-300) and or AKR7A Antibody (H-300) conjugates.


1 total citations
Loading citations.
 
AKR7A Antibody (H-300) Data
Click on image to enlarge
sc-32944
AKR7A (H-300): sc-32944. Western blot analysis of AKR7A3 expression in non-transfected 293T: sc-117752 (A), human AKR7A3 transfected 293T: sc-114340 (B) and Hep G2 (C) whole cell lysates.
sc-32944
AKR7A (H-300): sc-32944. Western blot analysis of AKR7A3 expression in non-transfected 293T: sc-117752 (A), human AKR7A3 transfected 293T: sc-114111 (B) and HeLa (C) whole cell lysates.
sc-32944
AKR7A (H-300): sc-32944. Western blot analysis of AKR7 expression in 293T (A) and HL-60 (B) whole cell lysates.
sc-32944
AKR7A (H-300): sc-32944. Western blot analysis of AKR7 Aexpression in non-transfected 293T: sc-117752 (A), human AKR7 transfected 293T: sc-173942 (B) and HL-60 (C) whole cell lysates.
sc-32944
AKR7A (H-300): sc-32944. Western blot analysis of AKR7A expression in non-transfected 293T: sc-117752 (A), human AKR7 transfected 293T: sc-173982 (B) and Hep G2 (C) whole cell lysates.
sc-32944
AKR7A (H-300): sc-32944. Immunoperoxidase staining of formalin fixed, paraffin-embedded human stomach tissue showing cytoplasmic and nuclear staining of glandular cells in low (A) and high (B) resolution. Kindly provided by The Swedish Human Protein Atlas (HPA) program.
sc-32944
AKR7A (H-300): sc-32944. Western blot analysis of AKR7A2 expression in non-transfected: sc-110760 (A) and human AKR7A2 transfected: sc-111315 (B) 293 whole cell lysates.
Download
Datasheets
Get Adobe Acrobat Reader