Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Membrane Receptors » GRPR Antibodies » GRPR Antibody (M-50): sc-32904

GRPR Antibody (M-50): sc-32904

 |  Datasheet

(Based on data analysis)

  • GRPR Antibody (M-50) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-50 mapping at the N-terminus of GRPR of mouse origin
  • recommended for detection of GRPR of mouse and rat origin by WB, IP, IF and ELISA
 
Full-length GRPR protein sequence with immunogen highlighted:
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMTSFKSTNPSATFSLINRNICHEGYV

See additional GRPR Antibodies.

Also see GRPR Inhibitors for functional analysis of cellular responses to GRPR.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
GRPR Antibody (M-50) sc-32904 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
GRPR siRNA (m) sc-145783 10 µM $258
GRPR (m)-PR sc-145783-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
GRPR shRNA Plasmid (m) sc-145783-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
GRPR shRNA (m) Lentiviral Particles sc-145783-V 200 µl $625
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Mouse Grpr 14829 X F5 P21729
 N/A
 

Gastrin-Releasing Peptide (GRP) stimulates the release of gastrin as well as other gastrointestinal hormones in addition to acting as an autocrine growth factor for certain cell types. The human GRP receptor (GRPR) gene maps to chromosome Xp21.2-p22.3 and encodes a seven transmembrane domain protein. Whereas normal human pancreas and stomach express GRPR, normal lung, colon and prostate do not. Well-differentiated colon tumors coexpress GRP and GRPR. Prostate carcinoma also expresses GRPR. Following exposure to nicotine, human lung fibroblasts increase expression of GRPR. Aberrent GRPR expression occurs more frequently in female normal lung than male normal lung, and may account for the increased susceptibility of women to tobacco-induced lung cancer.

GRPR Antibody (M-50) Data
Click on image to enlarge
sc-32904
GRPR (M-50): sc-32904. Immunoperoxidase staining of formalin fixed, paraffin-embedded human esophagus tissue showing cytoplasmic staining of squamous epithelial cells.
Download
Datasheets
Get Adobe Acrobat Reader