Welcome to Santa Cruz Biotechnology!

AHSP Antibody (FL-102): sc-292377

 |  Datasheet

(Based on data analysis)

  • AHSP Antibody (FL-102) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-102 representing full length AHSP of human origin
  • recommended for detection of AHSP of human origin by WB, IP, IF and ELISA
 
Full-length AHSP protein sequence with immunogen highlighted:
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPS

See additional AHSP Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
AHSP Antibody (FL-102) sc-292377 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human AHSP 51327 16p11.2 NM_016633 Q9NZD4
605821
 


å-hemoglobin stabilizing protein (AHSP), also designated erythroid associated factor (ERAF), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of å-hemoglobin during normal erythroid cell development. It specifically protects free å-hemoglobin from precipitation in live cells and in solution. It forms a heterodimer with free å-hemoglobin, but not with ∫-hemoglobin or hemoglobin A (å2-∫-2). AHSP localizes to the cytoplasm and is expressed in the blood and bone marrow. The AHSP protein is downregulated in transmissible spongiform encephalopathies (TSEs). AHSP may regulate pathological states of å-hemoglobin excess such as ∫-thalassemia, a group of hereditary disorders involving the decreased production of normal adult hemoglobin (HbA) that are characterized by a deficiency in the synthesis of ∫-globin chains.

AHSP Antibody (FL-102) Data
Click on image to enlarge
AHSP (FL-102): sc-292377. Western blot analysis of AHSP expression in human PBL whole cell lysate.
Download