CBX7 Antibody (M-85) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

CBX7 Antibody (M-85): sc-292141	\| Datasheet

5 3 (Based on data analysis) 1

CBX7 Antibody (M-85) is a rabbit polyclonal IgG provided at 200 µg/ml
epitope corresponding to amino acids 74-158 mapping at the C-terminus of CBX7 of mouse origin
recommended for detection of CBX7 of mouse and rat origin by WB, IP, IF and ELISA
TransCruz reagent for Gel Supershift and ChIP applications, sc-292141 X, 200 µg/0.1 ml

Full-length CBX7 protein sequence with immunogen highlighted:

MELSAIGEQVFAVESIRKKRVRKGKVEYLV See more...

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL

See additional CBX Antibodies including CBX, CBX6 and CBX7.

Ordering InformationGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF

Ordering Information

Product Name	Catalog #	Unit	Price	Qty	Add
CBX7 Antibody (M-85)	sc-292141	200 µg/ml	$279
CBX7 Antibody (M-85) X	sc-292141 X	200 µg/0.1 ml	$279

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Mouse	Cbx7	52609	15 E1	NM_144811	Q8VDS3	N/A

CBX7 (Chromobox protein homolog 7) is a 251 amino acid nuclear protein that contains one N-terminal chromo domain and one C-terminal Pc box. Highly expressed in kidney, brain, heart and skeletal muscle, with weaker expression in peripheral blood leukocytes, CBX7 functions as a component of the chromatin-associated polycomb complex (PcG) and is involved in maintaining the transcriptionally repressed state of target genes. Additionally, CBX7 modifies chromatin and is thought to extend the cellular life span of epithelial cells by repressing p14 ARF expression, while simultaneously repressing telomerase activity. Due to its ability to repress the transcription of cell-cycle related proteins, CBX7 is thought to play a role in tumorigenesis, specifically in the development of follicular lymphoma and thyroid cancer.

CBX7 Antibody (M-85) Data

Click on image to enlarge

CBX7 (M-85): sc-292141. Western blot analysis of CBX7 expression in non-transfected: sc-117752 (A) and mouse CBX7 transfected: sc-119054 (B) 293T whole cell lysates.

Download

Datasheets

Get Adobe Acrobat Reader

CBX7 Antibody (M-85): sc-292141