Welcome to Santa Cruz Biotechnology!

Rab 1 Antibody (FL-205): sc-28566

 |  Datasheet

(Based on data analysis)

  • Rab 1 Antibody (FL-205) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-205 representing full length Rab 1A of human origin
  • recommended for detection of Rab 1A, 1B and 1C; partially cross-reactive with other Rab family members of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 3 citations for Rab 1 Antibody (FL-205)
 
Full-length Rab 1 protein sequence with immunogen highlighted:
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

See additional Rab Antibodies including Rab, Rab 1, Rab 15, Rab 17, Rab 1A, Rab 1B, Rab 26, Rab 30, Rab 35, Rab 37, Rab 39B, Rab 3C, Rab 40AL, Rab 41, Rab 44, Rab 6B, Rab 6C, Rab L2A, Rab L5, Rab 2, Rab 2A, Rab 2B, Rab L2B, Rab 3, Rab 3A, Rab 3B, Rab 3D, Rab L3, Rab 4, Rab 4A, Rab 4B, Rab L4, Rab 5, Rab 5A, Rab 5B, Rab 5C, Rab 6, Rab 6A, Rab 7, Rab 7b, Rab 8, Rab 8A, Rab 8B, Rab 9, Rab 9A, Rab 9B, Rab 10, Rab 11, Rab 11A, Rab 11B, Rab 12, Rab 13, Rab 14, Rab 16, Rab 18, Rab 19, Rab 20, Rab 21, Rab 22A, Rab 23, Rab 24, Rab 25, Rab 27a, Rab 27b, Rab 28, Rab 31, Rab 32, Rab 33A, Rab 33B, Rab 34, Rab 36, Rab 38, Rab 40A, Rab 40B, Rab 40C, Rab 42, Rab 43, Rab 45 and Rab 7L1.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Rab 1 Antibody (FL-205) sc-28566 200 µg/ml $279
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
Rab 1B (h): 293T Lysate sc-117417 100 µg/200 µl $205
Rab 1B (m): 293T Lysate sc-122884 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human RAB1A 5861 2p14 NM_004161 P62820
179508
Mouse Rab1 19324 11 A3.1 P62821
N/A
Mouse Rab1b 76308 19 A Q9D1G1
N/A
 


The Ras-related superfamily of guanine nucleotide binding proteins, which includes the R-Ras, Rap, Ral/Rec and Rho/Rab subfamilies, exhibits 30-60% homology with Ras p21 (1,2). Accumulating data suggests an important role for Rab proteins, either in endocytosis or in biosynthetic protein transport (1-3). The transport of newly synthesized proteins from the endoplasmic reticulum to various stacks of the Golgi complex and to secretory vesicles involves at each stage the movement of carrier vesicles, a process that appears to involve Rab protein function (5-8). The possibility that Rab proteins might also direct the exocytosis from secretory vesicles to the plasma membrane is supported by the observation that in yeast, the SEC4 protein, which is 40% homologous to Rab proteins, is associated with secretory vesicles (4,9). At least eight members of the Rab subfamily have been identified, each of which is found at a particular stage of a membrane transport pathway (2,3,10).

Rab 1 Antibody (FL-205) Product Citations
See how others have used Rab 1 Antibody (FL-205) and or Rab 1 Antibody (FL-205) conjugates.


3 total citations
Loading citations.
 
Rab 1 Antibody (FL-205) Data
Click on image to enlarge
Rab 1 (FL-205): sc-28566. Western blot analysis of Rab 1 expression in human platelet (A) and JEG-3 (B) whole cell lysates.
Rab 1 (FL-205): sc-28566. Western blot analysis of Rab 1B expression in non-transfected 293T: sc-117752 (A), human Rab 1B transfected 293T: sc-117417 (B) and HeLa (C) whole cell lysates.
Rab 1 (FL-205): sc-28566. Western blot analysis of Rab 1B expression in non-transfected: sc-117752 (A) and mouse Rab 1B transfected: sc-122884 (B) 293T whole cell lysates.
Rab 1 (FL-205): sc-28566. Western blot analysis of Rab 1A expression in non-transfected: sc-117752 (A) and mouse Rab 1A transfected: sc-125876 (B) 293T whole cell lysates.
Rab 1 (FL-205): sc-28566. Western blot analysis of Rab 1 expression in NIH/3T3 whole cell lysate (A) and mouse eye tissue extract (B).
Download