Welcome to Santa Cruz Biotechnology!

FANCF Antibody (H-310): sc-28218

 |  Datasheet

(Based on data analysis)

  • FANCF Antibody (H-310) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 41-350 of FANCF of human origin
  • recommended for detection of FANCF of human origin by WB, IP, IF and ELISA
 
Full-length FANCF protein sequence with immunogen highlighted:
MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV

See additional FANC Antibodies including FANC, FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCI, FANCL, FANCM and FANCD2.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
FANCF Antibody (H-310) sc-28218 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FANCF siRNA (h) sc-40570 10 µM $258
FANCF (h)-PR sc-40570-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FANCF shRNA Plasmid (h) sc-40570-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FANCF shRNA (h) Lentiviral Particles sc-40570-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FANCF (h): 293T Lysate sc-112398 100 µg/200 µl $205
Control 293T Lysate sc-117752 100 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human FANCF 2188 11p14.3 NM_022725 Q9NPI8
603467
 


Fanconi anemia (FA) is an autosomal recessive disorder characterized by bone marrow failure, birth defects, and chromosomal instability. At the cellular level, FA is characterized by spontaneous chromosomal breakage and a unique hypersensitivity to DNA cross-linking agents. At least 8 complementation groups (A-G) have been identified and 6 FA genes (for subtypes A, C, D2, E, F, and G) have been cloned. The FA proteins lack sequence homologies or motifs that could point to a molecular function. Phosphorylation of FANC (Fanconi anemia complementation group) proteins is thought to be important for the function of the FA pathway. FA proteins are encoded by 6 cloned FA genes (FANCA, FANCC, FANCD2, FANCE, FANCF, and FANCG) and cooperate in a common pathway, culminating in the monoubiquitination of FANCD2 protein and colocalization of FANCD2 and BRCA1 proteins in nuclear foci. FANCF protein is required for FANCD2 activation and appears to stabilize other subunits of the complex. The human FANCF gene maps to chromosome 11p15 and encodes a nuclear protein with homology to the prokaryotic RNA-binding protein ROM.

FANCF Antibody (H-310) Data
Click on image to enlarge
FANCF (H-310): sc-28218. Western blot analysis of FANCF expression in non-transfected: sc-117752 (A) and human FANCF transfected: sc-112398 (B) 293T whole cell lysates.
Download