Hint1 Antibody (B-5) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

Hint1 Antibody (B-5): sc-271790	\| Datasheet

5 5 (Based on data analysis) 1

Hint1 Antibody (B-5) is a mouse monoclonal IgG_2b provided at 200 µg/ml
raised against amino acids 8-47 mapping near the N-terminus of Hint 1 of human origin
recommended for detection of Hint1 of human origin by WB, IP, IF and ELISA

Full-length Hint1 protein sequence with immunogen highlighted:

MADEIAKAQVARPGGDTIFGKIIRKEIPA See more...

MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

See additional Hint Antibodies including Hint, Hint1, Hint3 and Hint2.

Ordering InformationGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Human	HINT1	3094	5q23.3	NM_005340	P49773	601314
Mouse	Hint1	15254	11 B1.3	NM_008248	P70349	N/A

Hint1 (histidine triad nucleotide binding protein 1), also known as PRKCNH1 or PKCI1, is a 126 amino acid protein that localizes to both the cytoplasm and the nucleus and contains one HIT (histidine triad) domain. Widely expressed and existing as a homodimer, Hint1 functions to hydrolyze adenosine 5'-monophosphoramidate substrates, such as AMP-N-alanine methyl ester, AMP-morpholidate and AMP-alpha-acetyl lysine methyl ester, and may also inhibit PKC function and influence apoptosis. Knockdown of Hint1 mRNA results in downregulation of p53 and Bax, suggesting that Hint1 is a haplo-insufficient tumor suppressor. Also, it is suspected that promoter hypermethylation of the gene encoding Hint1 may play a role in hepatocarcinogenesis.

Hint1 Antibody (B-5) Data

Click on image to enlarge

Hint1 (B-5): sc-271790. Western blot analysis of Hint1 expression in Jurkat (A) and Hep G2 (B) whole cell lysates.

Hint1 (B-5): sc-271790. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.

Download

Datasheets

Get Adobe Acrobat Reader

Hint1 Antibody (B-5): sc-271790