ATE1 Antibody (H-12) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

ATE1 Antibody (H-12): sc-271219	\| Datasheet

5 5 (Based on data analysis) 1

ATE1 Antibody (H-12) is a mouse monoclonal IgG_2a provided at 200 µg/ml
raised against amino acids 1-300 mapping at the N-terminus of ATE1 of human origin
recommended for detection of ATE1 isoforms 1 and 2 of human origin by WB, IP, IF, IHC(P) and ELISA

Full-length ATE1 protein sequence with immunogen highlighted:

MAFWAGGSPSVVDYFPSEDFYRCGYCKNES See more...

MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQVIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN

See additional ATE1 Antibodies.

Ordering InformationGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF IHC(P)

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Human	ATE1	11101	10q26.13	NM_001001976, NM_007041	NP_001001976	607103
Mouse	Ate1	11907	7 F3	NM_001029895, NM_001136054, NM_013799	Q9Z2A5	N/A

Arginyl-tRNA-protein transferase (ATE1), also designated arginyltransferase 1, belongs to the R-transferase family of proteins. In order for a protein to be degraded via the ubiquitin pathway, arginylation of the protein is required. ATE1 plays an important role in this process, as it is important for the posttranslational conjugation of arginine to the N-terminal aspartate-, glutamate- and possibly cystine-contaning substrates. ATE1 is a 518 amino acid protein. Alternative splicing results in two distinct isoforms. ATE1, which is found as a monomer, can localize to the cytoplasm and/or the nucleus.

ATE1 Antibody (H-12) Data

Click on image to enlarge

ATE1 (H-12): sc-271219. Immunoperoxidase staining of formalin fixed, paraffin-embedded human adrenal gland tissue showing cytoplasmic staining of glandular cells.

ATE1 (H-12): sc-271219. Western blot analysis of ATE1 expression in HeLa whole cell lysate.

ATE1 (H-12): sc-271219. Western blot analysis of ATE1 expression in Hep G2 (A), MDA-MB-231 (B) and Jurkat (C) whole cell lysates.

Download

Datasheets

Get Adobe Acrobat Reader

ATE1 Antibody (H-12): sc-271219