Welcome to Santa Cruz Biotechnology!

Calponin 3 Antibody (G-11): sc-271189

 |  Datasheet

(Based on data analysis)

  • Calponin 3 Antibody (G-11) is a mouse monoclonal IgM provided at 200 µg/ml
  • raised against amino acids 275-329 mapping at the C-terminus of Calponin 3 of human origin
  • recommended for detection of Calponin 3 of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length Calponin 3 protein sequence with immunogen highlighted:
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY

See additional Calponin Antibodies including Calponin, Calponin 1, Calponin 2 and Calponin 3.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Calponin 3 Antibody (G-11) sc-271189 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CNN3 1266 1p21.3 NM_001839 NP_001830
602374
Mouse Cnn3 71994 3 G1 NM_028044 Q9DAW9
N/A
 


Calponin regulates smooth muscle cell contraction and is a marker of smooth muscle cell differentiation. Calponin, an Actin- and Tropomyosin-binding protein, is characterized as an inhibitory factor of smooth-muscle actomyosin activity. Calponin is implicated in the regulation of smooth muscle contraction through its interaction with F-Actin and inhibition of the Actin-activated MgATPase activity of phosphorylated myosin. Both properties are lost following phosphorylation (primarily at Serine 175) by protein kinase C or calmodulin-dependent protein kinase II. The three forms of Calponin, Calponin 1 (basic Calponin), Calponin 2 (neutral Calponin) and Calponin 3 (acidic Calponin) are found in smooth muscle tissue. Additionally, Calponin 2 is found in heart muscle tissue and Calponin 3 is found in the brain.

Calponin 3 Antibody (G-11) Data
Click on image to enlarge
Calponin 3 (G-11): sc-271189. Immunoperoxidase staining of formalin fixed, paraffin-embedded human duodenum tissue showing cytoplasmic staining of glandular cells.
Download