Endophilin B2 Antibody (C-10) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

Endophilin B2 Antibody (C-10): sc-271129	\| Datasheet

5 3 (Based on data analysis) 1

Endophilin B2 Antibody (C-10) is a mouse monoclonal IgG₁ provided at 200 µg/ml
raised against amino acids 81-140 mapping near the N-terminus of Endophilin B2 of human origin
recommended for detection of Endophilin B2 of human origin by WB, IP, IF, IHC(P) and ELISA

Full-length Endophilin B2 protein sequence with immunogen highlighted:

MDFNMKKLASDAGIFFTRAVQFTEEKFGQA See more...

MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS

See additional Endophilin Antibodies including Endophilin, Endophilin B1, Endophilin I, Endophilin II, Endophilin III and Endophilin B2.

Ordering InformationGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF IHC(P)

Ordering Information

Product Name	Catalog #	Unit	Price	Qty	Add
Endophilin B2 Antibody (C-10)	sc-271129	200 µg/ml	$279

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Human	SH3GLB2	56904	9q34.11	NM_020145	NP_064530	609288
Mouse	Sh3glb2	227700	2 B	NM_139302	Q8R3V5	N/A

The Endophilins comprise a family of proteins that associate with Amphiphysin, Synaptojanin and Dynamin and are implicated in presynaptic vesicle trafficking at nerve terminals. The expression patterns of the Endophilins are consistent with their cellular functions at the neuronal synapse. Endophilin B1 is a member of the B subgroup of the Endophilin family that is required for maintenance of mitochondrial morphology and for the regulation of the outer mitochondrial membrane dynamics. Endophilin B2 is also a member of the Endophilin B subroup that is ubiquitously expressed but shows highest levels in brain, adult lung, ovary, and spinal cord. Decreased levels of Endophilin B2 are found in Down Syndrome and may reflect brain dysgenesis.

Endophilin B2 Antibody (C-10) Data

Click on image to enlarge

Endophilin B2 (C-10): sc-271129. Immunoperoxidase staining of formalin fixed, paraffin-embedded human urinary bladder tissue showing cytoplasmic staining of urothelial cells.

Endophilin B2 (C-10): sc-271129. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.

Endophilin B2 (C-10): sc-271129. Western blot analysis of Endophilin B2 expression in non-transfected: sc-117752 (A) and human Endophilin B2 transfected: sc-177187 (B) 293T whole cell lysates.

Download

Datasheets

Get Adobe Acrobat Reader

Endophilin B2 Antibody (C-10): sc-271129