Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Homeodomain Proteins » Pax Antibodies » Pax-9 Antibody (H-95): sc-25410

Pax-9 Antibody (H-95): sc-25410

 |  Datasheet

(Based on data analysis)
  • Pax-9 Antibody (H-95) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 247-341 mapping at the C-terminus of Pax-9 of human origin
  • recommended for detection of Pax-9 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including canine, bovine and porcine
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-25410 X, 200 µg/0.1 ml
 
Full-length Pax-9 protein sequence with immunogen highlighted:
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL

See additional Pax Antibodies including Pax, Pax-1, Pax-2, Pax-3, Pax-4, Pax-5, Pax-6, Pax-7, Pax-8 and Pax-9.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   Gel Shift   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Pax-9 Antibody (H-95) sc-25410 200 µg/ml $279
Pax-9 Antibody (H-95) X sc-25410 X 200 µg/0.1 ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Pax-9 siRNA (h) sc-38756 10 µM $258
Pax-9 siRNA (m) sc-38757 10 µM $258
Pax-9 (h)-PR sc-38756-PR 10 µM, 20 µl $23
Pax-9 (m)-PR sc-38757-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Pax-9 shRNA Plasmid (h) sc-38756-SH 20 µg $520
Pax-9 shRNA Plasmid (m) sc-38757-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Pax-9 shRNA (h) Lentiviral Particles sc-38756-V 200 µl $625
Pax-9 shRNA (m) Lentiviral Particles sc-38757-V 200 µl $625
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human PAX9 5083 14q13.3 NM_006194 P55771
 604625
Mouse Pax9 18511 12 C1 P47242
 N/A
 

Pax genes contain paired domains with strong homology to genes in Droso-phila which are involved in programming early development. Pax-9, a member of the paired box-containing gene family, is closely related in its paired do-main to Pax-1. The Pax-9 gene encodes the highly conserved paired domain and the gene is a member of the same subgroup as Pax-1/undulated. Pax-9 is essential for the development of a variety of organs and skeletal elements. Mutations in either the Pax-1 or the Pax-9 genes may produce an inherited skeletal disorder such as the Jarcho-Levin syndrome or other forms of spondylocostal dysplasia, conditions resembling “undulated” in the mouse. A frameshift mutation within the paired domain of Pax-9 was identified in a family segregating autosomal dominant oligodontia whose members had normal primary dentition but lacked most permanent molars. In addition to lack of permanent molars, some individuals also lacked maxillary and/or mandibular second premolars, as well as mandibular central incisors. The gene which encodes Pax-9 maps to human chromosome 14q12-q13.