Welcome to Santa Cruz Biotechnology!

ATP6E Antibody (FL-226): sc-20946

 |  Datasheet

(Based on data analysis)

  • ATP6E Antibody (FL-226) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-226 ATP6E of human origin
  • recommended for detection of ATP6E of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 4 citations for ATP6E Antibody (FL-226)
 
Full-length ATP6E protein sequence with immunogen highlighted:
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFL

See additional ATP6 Antibodies including ATP6, ATP6E1, ATP6V0E1, ATP6V0E2, ATP6E, ATP6F, ATP6L and ATP6AP1.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
ATP6E Antibody (FL-226) sc-20946 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ATP6E siRNA (h) sc-36793 10 µM $258
ATP6E siRNA (m) sc-36794 10 µM $258
ATP6E (h)-PR sc-36793-PR 10 µM, 20 µl $23
ATP6E (m)-PR sc-36794-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ATP6E shRNA Plasmid (h) sc-36793-SH 20 µg $520
ATP6E shRNA Plasmid (m) sc-36794-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ATP6E shRNA (h) Lentiviral Particles sc-36793-V 200 µl $625
ATP6E shRNA (m) Lentiviral Particles sc-36794-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
mouse brain extract sc-2253 500 µg/200 µl $104
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
F9 Cell Lysate sc-2245 500 µg/200 µl $104
KNRK Whole Cell Lysate sc-2214 500 µg/200 µl $104
ATP6E (m): 293T Lysate sc-118629 100 µg/200 µl $205
ATP6E1 (h): 293 Lysate sc-110889 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ATP6V1E1 529 22q11.21 NM_001039366, NM_001039367, NM_001696 P36543
108746
Human ATP6V1E2 90423 2p21 NM_080653 Q96A05
n/a
Mouse Atp6v1e1 11973 6 F1 P50518
N/A
 


ATP6E, also known as V-ATPase E, is a vacuolar-type H+-ATPase (V-ATPase). V-ATPase is a multisubunit enzyme responsible for acidification of eukaryotic intracellular organelles. V-ATPases pump protons against an electrochemical gradient, while F-ATPases reverse the process, thereby synthesizing ATP. A peripheral V1 domain, which is responsible for ATP hydrolysis, and an integral V0 domain, which is responsible for proton translocation, compose V-ATPase. Nine subunits (A-H) make up the V1 domain and five subunits (a, d, c, c' and c") make up the V0 domain. Like F-ATPase, V-ATPase most likely operates through a rotary mechanism. ATP6E controls acidification of the vacuolar system and provides the main proton-motive force.

ATP6E Antibody (FL-226) Product Citations
See how others have used ATP6E Antibody (FL-226) and or ATP6E Antibody (FL-226) conjugates.


4 total citations
Loading citations.
 
ATP6E Antibody (FL-226) Data
Click on image to enlarge
ATP6E (FL-226): sc-20946. Western blot analysis of ATP6E expression in HeLa whole cell lysate (A) and mouse brain tissue extract (B).
V-ATPase E (FL-226): sc-20946. Immunoperoxidase staining of formalin fixed, paraffin-embedded human kidney tissue showing cytoplasmic and membrane staining of cells in tubuli at low (A) and high (B) magnification. Kindly provided by The Swedish Human Protein Atlas (HPA) program.
ATP6E (FL-226): sc-20946. Western blot analysis of ATP6E expression in K-562 whole cell lysate.
ATP6E (FL-226): sc-20946. Western blot analysis of ATP6E expression in non-transfected: sc-117752 (A) and mouse ATP6E transfected: sc-110138 (B) 293T whole cell lysates.
Download