Welcome to Santa Cruz Biotechnology!

Ref-1 Antibody (C-4): sc-17774

 |  Datasheet

(Based on data analysis)

  • Ref-1 Antibody (C-4) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 1-300 of Ref-1 of human origin
  • recommended for detection of Ref-1 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-17774 X, 200 µg/0.1 ml
  • See 18 citations for Ref-1 Antibody (C-4)
 
Full-length Ref-1 protein sequence with immunogen highlighted:
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKRSKALGSDHCPITLYLAL

See additional Ref-1 Antibodies.

Also see Ref-1 Inhibitors for functional analysis of cellular responses to Ref-1.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   Gel Shift   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAddFavorites
Ref-1 Antibody (C-4) sc-17774 200 µg/ml $279
Ref-1 Antibody (C-4) X sc-17774 X 200 µg/0.1 ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
Ref-1 siRNA (h) sc-29470 10 µM $258
Ref-1 siRNA (m) sc-36401 10 µM $258
Ref-1 siRNA (r) sc-72399 10 µM $258
Ref-1 (h)-PR sc-29470-PR 10 µM, 20 µl $23
Ref-1 (m)-PR sc-36401-PR 10 µM, 20 µl $23
Ref-1 (r)-PR sc-72399-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
Ref-1 shRNA Plasmid (h) sc-29470-SH 20 µg $520
Ref-1 shRNA Plasmid (m) sc-36401-SH 20 µg $520
Ref-1 shRNA Plasmid (r) sc-72399-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
Ref-1 shRNA (h) Lentiviral Particles sc-29470-V 200 µl $625
Ref-1 shRNA (m) Lentiviral Particles sc-36401-V 200 µl $625
Ref-1 shRNA (r) Lentiviral Particles sc-72399-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
NIH/3T3 nuclear extract sc-2138 250 µg/0.05 ml $143
KNRK nuclear extract sc-2141 250 µg/0.05 ml $143
Ref-1 (h): 293T Lysate sc-176689 100 µg/200 µl $205
C32 nuclear extract sc-2136 250 µg/0.05 ml $143
A-431 nuclear extract sc-2122 250 µg/0.05 ml $143
BJAB Whole Cell Lysate sc-2207 500 µg/200 µl $104
COLO 320DM Cell Lysate sc-2226 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human APEX1 328 14q11.2 NM_001641, NM_080648, NM_080649 P27695
107748
Mouse Apex1 11792 14 C1 P28352
N/A
 


The role of transcription factors in the regulation of gene expression is well established. Although the activity of these factors can be regulated by phosphorylation, evidence has indicated regulation of DNA binding mediated by changes in reduction-oxidation (redox) status. Mutational analysis has identified a single conserved cysteine residue mapping within the DNA binding domains of Fos and Jun. Chemical oxidation or modification of this cysteine residue inhibits the DNA binding activity of Fos and Jun. A similar mode of regulation has been recently proposed for other nuclear transcription factors. Oxidation is reversible by these compounds or by a cellular redox/DNA repair protein identified originally as Ref-1 (redox factor 1). Ref-1 is identical to a previously characterized DNA repair enzyme designated HAP1, APE or APEX.

Ref-1 Antibody (C-4) Product Citations
See how others have used Ref-1 Antibody (C-4) and or Ref-1 Antibody (C-4) conjugates.


18 total citations
Loading citations.
 
Ref-1 Antibody (C-4) Data
Click on image to enlarge
Ref-1 (C-4): sc-17774. Immunofluorescence staining of methanol-fixed NIH/3T3 cells (A) and immunoperoxidase staining of formalin-fixed, paraffin-embedded human brain tumor (B) showing nuclear staining.
Ref-1 (C-4): sc-17774. Immunoperoxidase staining of formalin fixed, paraffin-embedded human cerebellum tissue showing nuclear staining of cells in granular and molecular layers. Kindly provided by The Swedish Human Protein Atlas (HPA) program.
Ref-1 siRNA (h): sc-29470. Immunofluorescence staining of methanol-fixed, control HeLa (A) and Ref-1 siRNA silenced HeLa (B) cells showing diminished nuclear staining in the siRNA silenced cells. Cells probed with Ref-1 (C-4): sc-sc-17774.
Ref-1 (C-4): sc-17774. Immunofluorescence staining of methanol-fixed NIH/3T3 cells (A) and immunoperoxidase staining of formalin-fixed, paraffin-embedded human brain tumor (B) showing nuclear staining.
Ref-1 (C-4): sc-17774. Western blot analysis of Ref-1 expression in NIH/3T3 (A) and KNRK (B) nuclear extracts.
Ref-1 (C-4): sc-17774. Western blot analysis of Ref-1 expression in non-transfected: sc-117752 (A) and human Ref-1 transfected: sc-176689 (B) 293T whole cell lysates.
Download