Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Signaling Intermediates » ISG Antibodies » ISG15 Antibody (F-9): sc-166755

ISG15 Antibody (F-9): sc-166755

 |  Datasheet

(Based on data analysis)

  • ISG15 Antibody (F-9) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-150 mapping at the N-terminus of ISG15 of human origin
  • recommended for detection of ISG15 of m and h origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length ISG15 protein sequence with immunogen highlighted:
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFNLRLRGGGTEPGGRS

See additional ISG Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
ISG15 Antibody (F-9) sc-166755 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ISG15 siRNA (h) sc-43869 10 µM $258
ISG15 (h)-PR sc-43869-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ISG15 shRNA Plasmid (h) sc-43869-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ISG15 shRNA (h) Lentiviral Particles sc-43869-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ISG15 (m): 293T Lysate sc-121117 100 µg/200 µl $205
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ISG15 9636 1p36.33 P05161
 147571
 

Interferon-induced 15 kDa protein (ISG15) acts as ubiquitin by conjugating to intracellular target proteins such as JAK1 or MAPK3/ERK1 through an enzyme pathway distinct from that of ubiquitin. ISG15 shows specific chemotactic activity towards neutrophils and activates them to induce the release of eosinophil chemotactic factors. ISG15 is also involved in paracrine, autocrine and endocrine mechanisms by inducing IFN-g secretion by monocytes and macrophages, as in cell-to-cell signaling. ISG15 is a cytoplasmic protein expressed mainly in muscle, epithelial, neuronal and lymphoid cells.
ISG15 Antibody (F-9) Data
Click on image to enlarge
sc-166755
ISG15 (F-9): sc-166755. Western blot analysis of ISG15 expression in non-transfected: sc-117752 (A) and mouse ISG15 transfected: sc-121117 (B) 293T whole cell lysates.
sc-166755
ISG15 (F-9): sc166755. Immunoperoxidase staining of formalin fixed, paraffin-embedded human esophagus tissue showing cytoplasmic staining of squamous epithelial cells.
Download
Datasheets
Get Adobe Acrobat Reader