Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Structural Proteins » p ARC Antibodies » p21-ARC Antibody (E-7): sc-166630

p21-ARC Antibody (E-7): sc-166630

 |  Datasheet

(Based on data analysis)

  • p21-ARC Antibody (E-7) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-178 representing full length p21-ARC of human origin
  • recommended for detection of p21-ARC of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Full-length p21-ARC protein sequence with immunogen highlighted:
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPG

See additional p ARC Antibodies including p ARC, p41-ARCa, p16-ARC, p20-ARC, p21-ARC, p34-ARC and p41-ARCb.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
p21-ARC Antibody (E-7) sc-166630 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
p21-ARC siRNA (h) sc-62731 10 µM $258
p21-ARC siRNA (m) sc-62732 10 µM $258
p21-ARC (h)-PR sc-62731-PR 10 µM, 20 µl $23
p21-ARC (m)-PR sc-62732-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
p21-ARC shRNA Plasmid (h) sc-62731-SH 20 µg $520
p21-ARC shRNA Plasmid (m) sc-62732-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
p21-ARC shRNA (h) Lentiviral Particles sc-62731-V 200 µl $625
p21-ARC shRNA (m) Lentiviral Particles sc-62732-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
3T3-L1 Cell Lysate sc-2243 500 µg/200 µl $104
K-562 Whole Cell Lysate sc-2203 500 µg/200 µl $104
SK-BR-3 Cell Lysate sc-2218 500 µg/200 µl $104
MCF7 Whole Cell Lysate sc-2206 500 µg/200 µl $104
p21-ARC (h): 293T Lysate sc-111419 100 µg/200 µl $205
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ARPC3 10094 12q24.11 O15145
 604225
Mouse Arpc3 56378 5 F Q9JM76
 N/A
 

The Arp2/3 (Actin-related protein 2/3) complex consists of seven subunits, all of which are actin-related proteins. The complex is involved in the control of actin polymerization and in mediating the formation of branched actin networks. p21-ARC, also known as ARPC3 (Actin-related protein 2/3 complex subunit 3) or ARC21 (Arp2/3 complex 21 kDa subunit), is a 178 amino acid actin-binding component of Arp2/3. Localized to the cytoplasm and cytoskeleton, p21-ARC is thought to interact with p20-ARC and play an important role in the structural integrity of the protein complex.
p21-ARC Antibody (E-7) Data
Click on image to enlarge
sc-166630
p21-ARC (E-7): sc-166630. Western blot analysis of p21-ARC expression in non-transfected: sc-117752 (A) and human p21-ARC transfected: sc-111419 (B) 293T whole cell lysates.
sc-166630
p21-ARC (E-7): sc-166630. Western blot analysis of p21-ARC expression in HeLa (A), SK-BR-3 (B), MCF7 (C), NIH/3T3 (D) and 3611-RF (E) whole cell lysates.
sc-166630
p21-ARC (E-7): sc-166630. Immunoperoxidase staining of formalin fixed, paraffin-embedded human urinary bladder tissue showing cytoplasmic and nuclear staining of urothelial cells.
Download
Datasheets
Get Adobe Acrobat Reader