Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Signaling Intermediates » STAMBP Antibodies » STAMBP Antibody (H-3): sc-166565

STAMBP Antibody (H-3): sc-166565

 |  Datasheet

(Based on data analysis)

  • STAMBP Antibody (H-3) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 161-270 mapping within an internal region of STAMBP of human origin
  • recommended for detection of STAMBP of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length STAMBP protein sequence with immunogen highlighted:
MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

See additional STAMBP Antibodies including STAMBP and STAMBPL1.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
STAMBP Antibody (H-3) sc-166565 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
STAMBP siRNA (h) sc-94512 10 µM $258
STAMBP siRNA (m) sc-153875 10 µM $258
STAMBP (h)-PR sc-94512-PR 10 µM, 20 µl $23
STAMBP (m)-PR sc-153875-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
STAMBP shRNA Plasmid (h) sc-94512-SH 20 µg $520
STAMBP shRNA Plasmid (m) sc-153875-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
STAMBP shRNA (h) Lentiviral Particles sc-94512-V 200 µl $625
STAMBP shRNA (m) Lentiviral Particles sc-153875-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
STAMBP (h2): 293T Lysate sc-159791 100 µg/200 µl $205
STAMBP (h): 293T Lysate sc-117052 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human STAMBP 10617 2p13.1 O95630
 606247
Mouse Stambp 70527 6 C3 Q9CQ26
 N/A
 

STMBP (STAM binding protein), also known as AMSH, is a 424 amino acid protein belonging to the peptidase M67C family. Ubiquitously expressed, STMBP functions as a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. STMBP is able to oppose the ubiquitin-dependent sorting of receptors to lysosomes. STMBP may play a role in signal transduction for cell growth and Myc induction mediated by IL-2 and GM-CSF. It is suggested that STMBP potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of Smad6 and Smad7. STMBP consists of the JAMM motif, which is essential for the protease activity, and is inhibited by N-ethylmaleimide.
STAMBP Antibody (H-3) Data
Click on image to enlarge
sc-166565
STAMBP (H-3): sc-166565. Western blot analysis of STAMBP expression in non-transfected: sc-117752 (A) and human STAMBP transfected: sc-159791 (B) 293T whole cell lysates.
sc-166565
STAMBP (H-3): sc-166565. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear localization.
sc-166565
STAMBP (H-3): sc-166565. Western blot analysis of STAMBP expression in non-transfected 293T: sc-117752 (A), human STAMBP transfected 293T: sc-117052 (B) and HeLa (C) whole cell lysates.
sc-166565
STAMBP (H-3): sc-166565. Western blot analysis of STAMBP expression in non-transfected: sc-117752 (A) and human STAMBP transfected: sc-170434 (B) 293T whole cell lysates.
sc-166565
STAMBP (H-3): sc-166565. Western blot analysis of STAMBP expression in A549 (A) and Jurkat (B) whole cell lysates.
sc-166565
STAMBP (H-3): sc-166565. Western blot analysis of STAMBP expression in K-562 (A) and HEL 92.1.7 (B) whole cell lysates.
sc-166565
STAMBP (H-3): sc-166565. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear localization.
sc-166565
STAMBP (H-3): sc-166565. Immunoperoxidase staining of formalin fixed, paraffin-embedded human urinary bladder tissue showing cytoplasmic and nuclear staining of urothelial cells.
Download
Datasheets
Get Adobe Acrobat Reader