Welcome to Santa Cruz Biotechnology!

ALDH1/2 Antibody (H-8): sc-166362

 |  Datasheet

(Based on data analysis)

  • ALDH1/2 Antibody (H-8) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 186-270 mapping within an internal region of ALDH1A1 of human origin
  • recommended for detection of ALDH1A1, ALDH1A2, ALDH1A3 and ALDH2 of mouse and human origin by WB, IP, IF and ELISA
  • See 1 citations for ALDH1/2 Antibody (H-8)
 
Full-length ALDH1/2 protein sequence with immunogen highlighted:
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS

See additional ALDH Antibodies including ALDH, ALDH1, ALDH1A7, ALDH2, ALDH1A1, ALDH1B1, ALDH1L1, ALDH1A2, ALDH1L2, ALDH1A3, ALDH3A1, ALDH3B1, ALDH3A2, ALDH3B2, ALDH4A1, ALDH5A1, ALDH6A1, ALDH8A1, ALDH9A1, ALDH16A1 and ALDH18A1.

Also see chemical ALDH1 Inhibitors or chemical ALDH2 Inhibitors for functional analysis of cellular responses to ALDH1 and ALDH2.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAddFavorites
ALDH1/2 Antibody (H-8) sc-166362 200 µg/ml $279
 CRISPR/Cas9 KO and HDR Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
ALDH2 CRISPR/Cas9 KO Plasmid (h) sc-400809 20 µg $345
ALDH2 HDR Plasmid (h) sc-400809-HDR 20 µg $385
ALDH2 CRISPR/Cas9 KO Plasmid (m) sc-419079 20 µg $345
ALDH2 HDR Plasmid (m) sc-419079-HDR 20 µg $385
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
mouse liver extract sc-2256 500 µg/200 µl $104
rat liver extract sc-2395 500 µg/200 µl $104
ALDH1A1 (m): 293T Lysate sc-118332 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ALDH2 217 12q24.12 P05091
100650
Mouse Aldh1a3 56847 7 C Q9JHW9
N/A
 


Aldehyde dehydrogenases (ALDHs) mediate NADP+-dependent oxidation of aldehydes into acids during the detoxification of alcohol-derived acetaldehyde; metabolism of corticosteroids, biogenic amines and neurotransmitters; and lipid peroxidation. ALDH1A1, also designated retinal dehydrogenase 1 (RalDH1 or RALDH1); aldehyde dehydrogenase family 1 member A1; aldehyde dehydrogenase cytosolic; ALDHII; ALDH-E1 or ALDH E1, is a retinal dehydrogenase that participates in the biosynthesis of retinoic acid (RA). The major liver isoform ALDH1 localizes to cytosolic space, while ALDH2 localizzes to the mitochondria. The ALDH1A2 (RALDH2, RALDH2-T) gene produces three different transcripts and also catalyzes the synthesis of RA from retinaldehyde. ALDH2 is present in most Caucasians, yet is absent in 50% of Asians. The absence of this enzyme has been linked to alcohol intolerance; and thusly, a reduced risk for alcoholism-related liver disease.

ALDH1/2 Antibody (H-8) Product Citations
See how others have used ALDH1/2 Antibody (H-8) and or ALDH1/2 Antibody (H-8) conjugates.


1 total citations
Loading citations.
 
ALDH1/2 Antibody (H-8) Data
Click on image to enlarge
ALDH1/2 (H-8): sc-166362. Western blot analysis of ALDH1A1 expression in non-transfected 293T: sc-117752 (A), mouse ALDH1A1 transfected 293T: sc-118332 (B) and Hep G2 (C) whole cell lysates.
ALDH1/2 (H-8): sc-166362. Western blot analysis of ALDH2 expression in non-transfected: sc-110760 (A) and human ALDH2 transfected: sc-158255 (B) 293 whole cell lysates.
ALDH1/2 (H-8): sc-166362. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
ALDH1/2 (H-8): sc-166362. Western blot analysis of ALDH1/2 expression in human skeletal muscle tissue extract.
Download