Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Tumor Suppressors/Apoptosis » galectin Antibodies » galectin-7 Antibody (H-8): sc-166222

galectin-7 Antibody (H-8): sc-166222

 |  Datasheet

(Based on data analysis)

  • galectin-7 Antibody (H-8) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 77-136 mapping at the C-terminus of galectin-7 of human origin
  • recommended for detection of galectin-7 of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length galectin-7 protein sequence with immunogen highlighted:
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

See additional galectin Antibodies including galectin, galectin-1, galectin-16, galectin-2, galectin-3, galectin-4, galectin-5, galectin-6, galectin-7, galectin-8, galectin-9, galectin-10, galectin-12, galectin-13 and galectin-14.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
galectin-7 Antibody (H-8) sc-166222 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
galectin-7 siRNA (h) sc-44534 10 µM $258
galectin-7 siRNA (m) sc-44535 10 µM $258
galectin-7 siRNA(h)-PR sc-44534-PR 10 µM, 20 µl $23
galectin-7 siRNA(m)-PR sc-44535-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
galectin-7 shRNA Plasmid (h)-SH sc-44534-SH 20 µg $520
galectin-7 shRNA Plasmid (m)-SH sc-44535-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
galectin-7 siRNAshRNA (h) Lentiviral Particles sc-44534-V 200 µl $625
galectin-7 siRNAshRNA (m) Lentiviral Particles sc-44535-V 200 µl $625
 WB Positive Control Cell Lysate (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
galectin-7 (h): 293T Lysate sc-117240 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Mouse Lgals7 16858 7 A3 O54974
 N/A
 

Galectins are a family of soluble b-galactoside-binding animal lectins that modulate cell-to-cell adhesion and cell-to-extracellular matrix (ECM) interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis. Galectin-7, expressed mainly in stratified squamous epithelium, is activated by p53 and repressed by retinoic acid. It is a pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. The galectin-7 gene maps to chromosome 19.
galectin-7 Antibody (H-8) Data
Click on image to enlarge
sc-166222
galectin-7 (H-8): sc-166222. Western blot analysis of galectin-7 expression in non-transfected: sc-117752 (A) and human galectin-7 transfected: sc-117240 (B) 293T whole cell lysates.
sc-166222
galectin-7 (H-8): sc-166222. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-166222
galectin-7 (H-8): sc-166222. Immunoperoxidase staining of formalin fixed, paraffin-embedded human oral mucosa tissue showing cytoplasmic staining of squamous epithelial cells.
Download
Datasheets
Get Adobe Acrobat Reader