NSF Antibody (H-300) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

NSF Antibody (H-300): sc-15339	\| Datasheet

5 5 (Based on data analysis) 1

NSF Antibody (H-300) is a rabbit polyclonal IgG provided at 200 µg/ml
epitope corresponding to amino acids 1-300 mapping at the N-terminus of NEM-sensitive fusion protein (NSF) of human origin
recommended for detection of NSF of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
See 4 citations for NSF Antibody (H-300)

Full-length NSF protein sequence with immunogen highlighted:

MAGRSMQAARCPTDELSLTNCAVVNEKDFQ See more...

MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESENIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD

See additional NSF Antibodies.

Ordering InformationProduct CitationsGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF IHC(P)

Ordering Information

Product Name	Catalog #	Unit	Price	Qty	Add
NSF Antibody (H-300)	sc-15339	200 µg/ml	$279

WB Positive Control Cell Lysates (click product name for more information)

Product Name	Catalog #	Unit	Price
mouse brain extract	sc-2253	500 µg/200 µl	$104
MIA PaCa-2 Cell Lysate	sc-2285	500 µg/200 µl	$104
SK-N-MC Cell Lysate	sc-2237	500 µg/200 µl	$104
SK-N-SH Cell Lysate	sc-2410	500 µg/200 µl	$104
SH-SY5Y Cell Lysate	sc-3812	500 µg/200 µl	$104
KNRK Whole Cell Lysate	sc-2214	500 µg/200 µl	$104
NSF (m): 293T Lysate	sc-125721	100 µg/200 µl	$205

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Human	NSF	4905	17q21.32	NM_006178	P46459	601633
Mouse	Nsf	18195	11 E1		P46460	N/A

Syntaxins were originally thought to be docking proteins, but have more recently been categorized as anchoring proteins that anchor themselves to the cytoplasmic surfaces of cellular membranes. Syntaxins have been shown to bind to various proteins involved in exocytosis, including VAMPs (vesicle-associated membrane proteins), NSF (N-ethylmaleimide-sensitive factor), SNAP 25 (synaptosomal-associated protein of 25kDa), SNAPs (soluble NSF attachment proteins) and synaptotagmin. VAMPs, also designated synaptobrevins, including VAMP-1 and VAMP-2, and synaptotagmin, a protein that may function as an inhibitor of exocytosis, are vesicular proteins. SNAPs, including a- and g-SNAP, are cytoplasmic proteins that bind to a membrane receptor complex composed of VAMP, SNAP 25 and syntaxin. SNAPs mediate the membrane binding of NSF, which is essential for membrane fusion reactions.

NSF Antibody (H-300) Product Citations

See how others have used NSF Antibody (H-300) and or NSF Antibody (H-300) conjugates.

4 total citations

Loading citations.

NSF Antibody (H-300) Data

Click on image to enlarge

NSF (H-300): sc-15339. Western blot analysis of NSF expression in mouse brain extract.

NSF (H-300): sc-15339. Immunofluorescence staining of methanol-fixed SK-N-SH cells showing cytoplasmic localization.

NSF (H-300): sc-15339. Immunoperoxidase staining of formalin fixed, paraffin-embedded human prostate cancer tissue showing cytoplasmic staining of tumor cells at low (A) and high (B) magnification. Kindly provided by The Swedish Human Protein Atlas (HPA) program.

NSF (H-300): sc-15339. Western blot analysis of NSF expression in non-transfected: sc-117752 (A) and mouse NSF transfected: sc-125721 (B) 293T whole cell lysates.

NSF (H-300): sc-15339. Western blot analysis of NSF expression in SK-N-MC (A), MIA PaCa-2 (B) and EOC 20 (C) whole cell lysates.

Download

Datasheets

Get Adobe Acrobat Reader

NSF Antibody (H-300): sc-15339