Welcome to Santa Cruz Biotechnology!

SMN Antibody (H-195): sc-15320

 |  Datasheet

(Based on data analysis)

  • SMN Antibody (H-195) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-195 mapping at the N-terminus of SMN (survival of motor neurons) (also designated Gemin1) of human origin
  • recommended for detection of SMN of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including porcine
  • See 10 citations for SMN Antibody (H-195)
 
Full-length SMN protein sequence with immunogen highlighted:
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

See additional SMN Antibodies.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
SMN Antibody (H-195) sc-15320 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
SMN siRNA (h) sc-36510 10 µM $258
SMN siRNA (m) sc-36511 10 µM $258
SMN (h)-PR sc-36510-PR 10 µM, 20 µl $23
SMN (m)-PR sc-36511-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
SMN shRNA Plasmid (h) sc-36510-SH 20 µg $520
SMN shRNA Plasmid (m) sc-36511-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
SMN shRNA (h) Lentiviral Particles sc-36510-V 200 µl $625
SMN shRNA (m) Lentiviral Particles sc-36511-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
SK-BR-3 nuclear extract sc-2134 250 µg/0.05 ml $143
K-562 nuclear extract sc-2130 250 µg/0.05 ml $143
Jurkat nuclear extract sc-2132 250 µg/0.05 ml $143
SK-BR-3 Cell Lysate sc-2218 500 µg/200 µl $104
SMN (h2): 293T Lysate sc-113432 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human SMN1 6606 5q13.2 NM_000344, NM_022874 Q16637
600354
Human SMN2 6607 5q13.2 NM_017411, NM_022875, NM_022876, NM_022877 Q16637
601627
Mouse Smn1 20595 13 D1 P97801
N/A
 


Spinal muscular atrophy (SMA) is an autosomal recessive neurodegenerative disease characterized by loss of motor neurons in the spinal cord. SMA is caused by deletion or loss-of-function mutations of SMN (survival of motor neuron) gene. SMN, also known as Gemin1, SMN1, SMNT and BCD541, exists as four isoforms produced by alternative splicing. SMN is oligomeric and forms a complex with Gemin2 (formerly SIP1), Gemin3 (a DEAD box RNA helicase), Gemin4, Gemin5 and Gemin6, as well as several spliceosomal snRNP proteins. The SMN complex plays an essential role in splicesomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing of the nucleus. The SMN complex is found in both the cytoplasm and the nucleus. The nuclear form is concentrated in subnuclear bodies called gems (gemini of the coiled bodies). Cytoplasmic SMN interacts with spliceosomal Sm proteins and facilitates their assembly onto U snRNAs, and nuclear SMN mediates recycling of pre-mRNA splicing factors. Nearly identical telomeric and centromeric forms of SMN encode the same protein; however, only mutations in the telomeric form are associated with the disease-state SMA. SMN is expresed in a wide variety of tissues including brain, kidney, liver, spinal cord and moderately in skeletal and cardiac muscle.

SMN Antibody (H-195) Product Citations
See how others have used SMN Antibody (H-195) and or SMN Antibody (H-195) conjugates.


10 total citations
Loading citations.
 
SMN Antibody (H-195) Data
Click on image to enlarge
SMN (H-195): sc-15320. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic and nuclear staining.
SMN (H-195): sc-15320. Western blot analysis of SMN expression in HeLa (A), SK-BR-3 (B) and K-562 nuclear extracts.
SMN (H-195): sc-15320. Immunoperoxidase staining of formalin fixed, paraffin-embedded human lung tumor tissue showing nuclear and cytoplasmic localization.
SMN (H-195): sc-15320. Immunoperoxidase staining of formalin fixed, paraffin-embedded human fallopian tube tissue showing nuclear and cytoplasmic staining of glandular cells (low and high magni?fication). Kindly provided by The Swedish Human Protein Atlas (HPA) program.
SMN (H-195): sc-15320. Western blot analysis of SMN expression in non-transfected: sc-117752 (A) and human SMN transfected: sc-113432 (B) 293T whole cell lysates.
SMN (H-195): sc-15320. Western blot analysis of SMN expression in 293T whole cell lysate.
SMN (H-195): sc-15320. Immunoperoxidase staining of formalin fixed, paraffin-embedded human testis tissue showing cytoplasmic and nuclear staining of cells in seminiferous ducts.
SMN (H-195): sc-15320. Immunofluorescence staining of formalin-fixed Hep G2 cells showing cytoplasmic and nuclear localization.
Download