Welcome to Santa Cruz Biotechnology!

CD3-ε Antibody (A-1): sc-137095

 |  Datasheet

(Based on data analysis)

  • CD3-ε Antibody (A-1) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-207 representing full length CD3-ε of human origin
  • recommended for detection of CD3-ε of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length CD3-ε protein sequence with immunogen highlighted:
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRR

See additional CD3 Antibodies including CD3, CD3-delta, CD3-epsilon, CD3-eta, CD3-gamma, CD3-theta and CD3-zeta.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
CD3-ε Antibody (A-1) sc-137095 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CD3-ε siRNA (h) sc-29989 10 µM $258
CD3-ε siRNA (m) sc-29990 10 µM $258
CD3-ε (h)-PR sc-29989-PR 10 µM, 20 µl $23
CD3-ε (m)-PR sc-29990-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CD3-ε shRNA Plasmid (h) sc-29989-SH 20 µg $520
CD3-ε shRNA Plasmid (m) sc-29990-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CD3-ε shRNA (h) Lentiviral Particles sc-29989-V 200 µl $625
CD3-ε shRNA (m) Lentiviral Particles sc-29990-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CCRF-CEM Cell Lysate sc-2225 500 µg/200 µl $104
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
CD3-ε (h): 293T Lysate sc-116055 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CD3E 916 11q23.3 P07766
186830
Mouse Cd3e 12501 9 A5.2 P22646
N/A
 


The T cell antigen receptor (TCR) recognizes foreign antigens and translates such recognition events into intracellular signals that elicit a change in the cell from a dormant to an activated state. Much of this signaling process can be attributed to a multisubunit complex of proteins that associates directly with the TCR. This complex has been designated CD3 (cluster of differentiation 3). It is composed of five invariant polypeptide chains that associate to form three dimers: a heterodimer of gamma and epsilon chains (CD3-© and CD3-é), a heterodimer of delta and epsilon chains (CD3-∂ and CD3-é) and a homodimer of two zeta chains (CD3-Ω) or a heterodimer of zeta and eta chains (CD3-Ω and CD3-h). CD3-Ω and CD3-h are encoded by the same gene, but differ in their carboxyl-terminal ends due to an alternative splicing event. CD3-©, CD3-é and CD3-∂ each contain a single copy of a conserved immunoreceptor tyrosine-based activation motif (ITAM). In contrast, CD3-Ω contains three consecutive copies of the same motif. Phosphorylated ITAMs act as docking sites for protein kinases such as ZAP-70 and Syk and are also capable of regulating their kinase activity. The crystal structure of the ZAP-70 SH2 domains bound to CD3-Ω ITAMs has been solved.

CD3-ε Antibody (A-1) Data
Click on image to enlarge
CD3-ε (A-1): sc-137095. Western blot analysis of CD3-ε expression in non-transfected 293T: sc-117752 (A), human CD3-ε transfected 293T: sc-116055 (B), Jurkat (C) and CCRF-CEM (D) whole cell lysates.
CD3-ε (A-1): sc-137095. Immunoperoxidase staining of formalin fixed, paraffin-embedded human appendix tissue showing membrane and cytoplasmic staining of lymphoid cells.
Download