Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Kinases and Phosphatases » MEK Antibodies » MEK-3/6 Antibody (B-1): sc-136982

MEK-3/6 Antibody (B-1): sc-136982

 |  Datasheet

(Based on data analysis)

  • MEK-3/6 Antibody (B-1) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 229-318 mapping at the C-terminus of MEK-3/6 of human origin
  • recommended for detection of MEK-3 and MEK-6 of mouse and human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length MEK-3/6 protein sequence with immunogen highlighted:
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

See additional MEK Antibodies including MEK, MEK, MEK-1, MEK-2, MEK-3, MEK-4, MEK-5, MEK-6 and MEK-7.

Also see MEK-7 Inhibitors for functional analysis of cellular responses to MEK-3 and MEK-6.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
MEK-3/6 Antibody (B-1) sc-136982 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MEK-3/6 siRNA (h) sc-43924 10 µM $258
MEK-3/6 (h)-PR sc-43924-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MEK-3/6 shRNA Plasmid (h) sc-43924-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MEK-3/6 shRNA (h) Lentiviral Particles sc-43924-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MEK-3 (h): 293T Lysate sc-114954 100 µg/200 µl $205
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
COLO 320DM Cell Lysate sc-2226 500 µg/200 µl $104
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
HeLa + PMA Cell Lysate sc-2258 500 µg/200 µl $104
KNRK Whole Cell Lysate sc-2214 500 µg/200 µl $104
MEK-3 (h2): 293T Lysate sc-176353 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human MAP2K3 5606 17p11.2 P46734
 602315
Human MAP2K6 5608 17q24.3 P52564
 601254
Mouse Map2k3 26397 11 B2 O09110
 N/A
Mouse Map2k6 26399 11 E2 P70236
 N/A
 

A family of protein kinases located upstream of the MAP kinases and responsible for their activation has been identified. The prototype member of this family, designated MAP kinase kinase, or MEK-1, specifically phosphorylates the MAP kinase regulatory threonine and tyrosine residues present in the Thr-Glu-Tyr motif of ERK. A second MEK family member, MEK-2, resembles MEK-1 in its substrate specificity. MEK-3 (or MKK-3) functions to activate p38 MAP kinase, and MEK-4 (also called SEK1 or MKK-4) activates both p38 and JNK MAP kinases. MEK-5 appears to specifically phosphorylate ERK5, whereas MEK-6 phosphorylates p38 and p38b. MEK-7 (or MKK-7) phosphorylates and activates the JNK signal transduction pathway.
MEK-3/6 Antibody (B-1) Data
Click on image to enlarge
sc-136982
MEK-3/6 (B-1): sc-136982. Immunofluorescence staining of methanol-fixed NIH/3T3 cells showing cytoplasmic localization.
sc-136982
MEK-3/6 (B-1): sc-136982. Western blot analysis of MEK-3 expression in non-transfected: sc-117752 (A) and human MEK-3 transfected: sc-114954 (B) 293T whole cell lysates.
sc-136982
MEK-3/6 (B-1): sc-136982. Western blot analysis of MEK-3 expression in non-transfected: sc-117752 (A) and human MEK-3 transfected: sc-114954 (B) 293T whole cell lysates.
sc-136982
MEK-3/6 (B-1): sc-136982. Western blot analysis of MEK-3 expression in non-transfected: sc-117752 (A) and human MEK-3 transfected: sc-176353 (B) 293T whole cell lysates.
sc-136982
MEK-3/6 (B-1): sc-136982. Western blot analysis of MEK-3/6 expression in NIH/3T3 (A) and K-562 (B) whole cell lysates.
sc-136982
MEK-3/6 (B-1): sc-136982. Immunoperoxidase staining of formalin fixed, paraffin-embedded human breast tissue showing cytoplasmic staining of glandular cells.
Download
Datasheets
Get Adobe Acrobat Reader