Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Structural Proteins » S-100 Antibodies » S-100A16 Antibody (FL-103): sc-135391

S-100A16 Antibody (FL-103): sc-135391

 |  Datasheet

(Based on data analysis)

  • S-100A16 Antibody (FL-103) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-103 representing full length S-100A16 of human origin
  • recommended for detection of S-100A16 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Full-length S-100A16 protein sequence with immunogen highlighted:
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSS

See additional S-100 Antibodies including S-100, S-100A7L2, S-100Z, S-100, S-100 alpha chain, S-100 beta chain, S-100P, S-100PBP, S-100A2, S-100A3, S-100A5, S-100A10, S-100A13, S-100A14 and S-100A16.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
S-100A16 Antibody (FL-103) sc-135391 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human S100A16 140576 1q21.3 NM_080388 Q96FQ6
 n/a
Mouse S100a16 67860 3 F1 NM_026416 NP_080692
 N/A
 

The S-100 protein family consists of a group of calcium-binding proteins that are exclusively expressed in vertebrates and exhibit cell and tissue-specific expression. The expression levels of its members differ in various pathological conditions. The extracellular functions of the S-100 family may include the ability to enhance neurite outgrowth, involvement in inflammation and motility of tumor cells. S-100A16 (S100 calcium binding protein A16), also known as AAG13 (aging-associated gene 13 protein), S100F or DT1P1A7, is a 103 amino acid nuclear and cytoplasmic protein that exists as a homodimer that binds one calcium ion per monomer. A member of the EF-hand superfamily, S-100A16 contains two EF-hand domains and is encoded by a gene that maps to human chromosome 1q21.3.

S-100A16 Antibody (FL-103) Data
Click on image to enlarge
sc-135391
S-100A16 (FL-103): sc-135391. Western blot analysis of S-100A16 expression in non-transfected 293T: sc-117752 (A), mouse S-100A16 transfected 293T: sc-123339 (B) and PC-3 (C) whole cell lysates.
Download
Datasheets
Get Adobe Acrobat Reader