Welcome to Santa Cruz Biotechnology!

LHPP Antibody (H-86): sc-134671

 |  Datasheet

(Based on data analysis)

  • LHPP Antibody (H-86) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 74-159 mapping within an internal region of LHPP of human origin
  • recommended for detection of LHPP of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Full-length LHPP protein sequence with immunogen highlighted:
MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

See additional LHPP Antibodies.

Ordering Information
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAddFavorites
LHPP Antibody (H-86) sc-134671 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
LHPP siRNA (h) sc-90377 10 µM $258
LHPP siRNA (m) sc-108656 10 µM $258
LHPP (h)-PR sc-90377-PR 10 µM, 20 µl $23
LHPP (m)-PR sc-108656-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
LHPP shRNA Plasmid (h) sc-90377-SH 20 µg $520
LHPP shRNA Plasmid (m) sc-108656-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
LHPP shRNA (h) Lentiviral Particles sc-90377-V 200 µl $625
LHPP shRNA (m) Lentiviral Particles sc-108656-V 200 µl $625


LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase), also known as HDHD2B, is a 270 amino acid protein that exists as a homodimer and is a member of the HAD-like hydrolase superfamily. Expressed in liver, kidney and moderately in brain, LHPP is encoded by a gene located on 10, which houses over 1,200 genes and comprises nearly 4.5% of the human genome. Defects in some of the genes that map to chromosome 10 are associated with Charcot-Marie Tooth disease, Jackson-Weiss syndrome, Usher syndrome, nonsyndromatic deafness, Wolman’s syndrome, Cowden syndrome, multiple endocrine neoplasia type 2 and porphyria.

LHPP Antibody (H-86) Data
Click on image to enlarge
LHPP (H-86): sc-134671. Western blot analysis of LHPP expression in mouse brain tissue extract (A) and Hep G2 whole cell lysate (B).
LHPP (H-86): sc-134671. Immunofluorescence staining of formalin-fixed Hep G2 cells showing cytoplasmic localization.
LHPP (H-86): sc-134671. Western blot analysis of LHPP expression in A549 whole cell lysate.
Download