Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Transcription Regulators » Smad Antibodies » Smad2/3 Antibody (C-8): sc-133098

Smad2/3 Antibody (C-8): sc-133098

 |  Datasheet

(Based on data analysis)

  • Smad2/3 Antibody (C-8) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 1-425 representing full length Smad3 of human origin
  • recommended for detection of Smad2 and Smad3 and to a lesser extent, Smad5, Smad1, and Smad8 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including canine and porcine
  • TransCruz reagent for Gel Supershift and ChIP applications sc-133098 X, 200 µg/0.1 ml
  • See 3 citations for Smad2/3 Antibody (C-8)
 
Full-length Smad2/3 protein sequence with immunogen highlighted:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSV

See additional Smad Antibodies including Smad, Smad1, Smad2, Smad3, Smad4, Smad5, Smad6, Smad7 and Smad8.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Smad2/3 Antibody (C-8) sc-133098 200 µg/ml $279
Smad2/3 Antibody (C-8) X sc-133098 X 200 µg/0.1 ml $279
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
K-562 Whole Cell Lysate sc-2203 500 µg/200 µl $104
U-937 Cell Lysate sc-2239 500 µg/200 µl $104
KNRK Whole Cell Lysate sc-2214 500 µg/200 µl $104
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human SMAD3 4088 15q22.33 P84022
 603109
Mouse Smad2 17126 18 E3 Q62432
 N/A
Mouse Smad3 17127 9 C Q8BUN5
 N/A
 

Smad proteins, the mammalian homologs of the Drosophila mothers against decapentaplegic (Mad), have been implicated as downstream effectors of TGF∫/BMP signaling. Smad1 (also designated Madr1 or JV4-1) and Smad5 are effectors of BMP-2 and BMP-4 function, while Smad2 (also designated Madr2 or JV18-1) and Smad3 are involved in TGF∫ and Activin-mediated growth modulation. Smad4 (also designated DPC4) has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to Activin/TGF∫ signaling by interfering with TGF∫-mediated phosphorylation of other Smad proteins.

Smad2/3 Antibody (C-8) Product Citations
See how others have used Smad2/3 Antibody (C-8) and or Smad2/3 Antibody (C-8) conjugates.


3 total citations
Loading citations.
 
Smad2/3 Antibody (C-8) Data
Click on image to enlarge
sc-133098
mad2/3 (C-8): sc-133098. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-133098
Smad2/3 (C-8): sc-133098. Western blot analysis of Smad2/3 expression in K-562 (A) and NIH/3T3 (B) whole cell lysates.
sc-133098
Smad2/3 (C-8): sc-133098. Western blot analysis of Smad2/3 expression in K-562 (A), U-937 (B), KNRK (C) and NIH/3T3 (D) whole cell lysates.
sc-133098
Smad2/3 (C-8): sc-133098. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-133098
Smad2/3 (C-8): sc-133098. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-133098
Smad2/3 (C-8): sc-133098. Immunoperoxidase staining of formalin fixed, paraffin-embedded human thyroid tissue showing nuclear staining of glandular cells.
Download
Datasheets
Get Adobe Acrobat Reader