Welcome to Santa Cruz Biotechnology!

ILK Antibody (H-300): sc-13075

 |  Datasheet

(Based on data analysis)

  • ILK Antibody (H-300) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 155-452 mapping at the C-terminus of ILK-1 of human origin
  • recommended for detection of ILK-1 and ILK-2 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 5 citations for ILK Antibody (H-300)
 
Full-length ILK protein sequence with immunogen highlighted:
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

See additional ILK Antibodies.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
ILK Antibody (H-300) sc-13075 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ILK siRNA (h) sc-35666 10 µM $258
ILK siRNA (m) sc-35667 10 µM $258
ILK (h)-PR sc-35666-PR 10 µM, 20 µl $23
ILK (m)-PR sc-35667-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ILK shRNA Plasmid (h) sc-35666-SH 20 µg $520
ILK shRNA Plasmid (m) sc-35667-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ILK shRNA (h) Lentiviral Particles sc-35666-V 200 µl $625
ILK shRNA (m) Lentiviral Particles sc-35667-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
rat heart extract sc-2393 500 µg/200 µl $104
mouse heart extract sc-2254 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ILK 3611 11p15.4 NM_001014794, NM_001014795, NM_004517 Q13418
602366
Mouse Ilk 16202 7 E3 O55222
N/A
 


Integrins are heterodimers composed of non-covalently associated transmembrane a and b subunits. The 16 a and 8 b subunits heterodimerize to produce more than 20 different receptors. Most integrin receptors bind to ligands that are components of the extracellular matrix. Certain integrins can also bind to soluble ligands such as Fibrinogen, or to counterreceptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), leading to aggregation of cells. In addition to mediating cell adhesion and cytoskeletal organization, integrins function as signaling receptors. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. ILK (integrin-linked kinase) was identified as a serine/threonine kinase that phosphorylates b1 and b3 integrins. ILK expression has been shown to be reduced in response to Fibronectin, a known integrin ligand. Overexpression of ILK was shown to upregulate the Fibronectin matrix assembly in epithelial cells, indicating a potential role for ILK in cell growth, cell survival and tumorigenesis.

ILK Antibody (H-300) Product Citations
See how others have used ILK Antibody (H-300) and or ILK Antibody (H-300) conjugates.


5 total citations
Loading citations.
 
ILK Antibody (H-300) Data
Click on image to enlarge
ILK (H-300): sc-13075. Western blot analysis of ILK expression in HeLa whole cell lysate.
ILK (H-300): sc-13075. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic staining.
Download