Welcome to Santa Cruz Biotechnology!

BID Antibody (FL-195): sc-11423

 |  Datasheet

(Based on data analysis)

  • BID Antibody (FL-195) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-195 representing full length BID of human origin
  • recommended for detection of BID of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA
  • agarose conjugate for IP studies, sc-11423 AC, 500 µg/0.25 ml agarose
  • See 58 citations for BID Antibody (FL-195)
 
Full-length BID protein sequence with immunogen highlighted:
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGM

See additional BID Antibodies.

Also see BID Inhibitors for functional analysis of cellular responses to BID.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
BID Antibody (FL-195) sc-11423 200 µg/ml $279
BID Antibody (FL-195) AC sc-11423 AC 500 µg/ml, 25% ag $366
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BID siRNA (h) sc-29800 10 µM $258
BID siRNA (m) sc-29801 10 µM $258
BID (h)-PR sc-29800-PR 10 µM, 20 µl $23
BID (m)-PR sc-29801-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BID shRNA Plasmid (h) sc-29800-SH 20 µg $520
BID shRNA Plasmid (m) sc-29801-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BID shRNA (h) Lentiviral Particles sc-29800-V 200 µl $625
BID shRNA (m) Lentiviral Particles sc-29801-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
WEHI-3 Cell Lysate sc-3815 500 µg/200 µl $104
RAW 264.7 Whole Cell Lysate sc-2211 500 µg/200 µl $104
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
DU 145 Cell Lysate sc-2268 500 µg/200 µl $104
PC-3 Cell Lysate sc-2220 500 µg/200 µl $104
MCF7 Whole Cell Lysate sc-2206 500 µg/200 µl $104
BID (h): 293T Lysate sc-115264 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human BID 637 22q11.21 NM_001196, NM_197966, NM_197967 P55957
601997
Mouse Bid 12122 6 F1 P70444
N/A
 


Members of the Bcl-2 family of proteins interact to regulate programmed cell death, or apoptosis. Various homodimers and heterodimers formed by proteins in this family can either promote or inhibit apoptosis. Bcl-2 blocks cell death following a variety of stimuli and confers a death-sparing effect on certain hematopoietic cell lines following growth factor withdrawal. Additional apoptotic inhibitors in this family include A1, Bag-1, Bcl-w, Bcl-x and Mcl-1. Pro-apoptotic members of this family include Bax, Bad, Bak, Bik (NBK) and BID. BID contains a BH3 domain which allows it to dimerize with and counter the death repressor effects of Bcl-2. BID has also been shown to heterodimerize with Bcl-x and the death agonist Bax. BID is localized predominantly in the cytosol and is also present in membrane fractions. It is highly expressed in kidney and can also be detected in brain, spleen, liver, testis and lung.

BID Antibody (FL-195) Product Citations
See how others have used BID Antibody (FL-195) and or BID Antibody (FL-195) conjugates.


58 total citations
Loading citations.
 
BID Antibody (FL-195) Data
Click on image to enlarge
BID (FL-195): sc-11423. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
BID siRNA (m): sc-29801. Western blot analysis of BID expression in non-transfected control (A) and BID siRNA transfected (B) WEHI-3 cells. Blot probed with BID (FL-195): sc-11423. GAPDH (FL-335): sc-25778 used as specificity and loading control.
BID siRNA (h): sc-29800. Western blot analysis of BID expression in non-transfected control (A) and BID siRNA transfected (B) HeLa cells. Blot probed with BID (FL-195): sc-11423. GAPDH (FL-335): sc-25778 used as specificity and loading control.
BID (FL-195): sc-11423. Western blot analysis of BID expression in non-transfected: sc-117752 (A) and mouse BID transfected: sc-118811 (B) 293T whole cell lysates.
BID (FL-195): sc-11423. Western blot analysis of BID expression in non-transfected 293T: sc-117752 (A), human BID transfected 293T: sc-128097 (B) and HeLa (C) whole cell lysates.
BID (FL-195): sc-11423. Western blot analysis of BID expression in HeLa (A), RAW 264.7 (B) and WEHI-231 (C) whole cell lysates.
BID (FL-195): sc-11423. Western blot analysis of BID expression in Jurkat whole cell lysate.
BID (FL-195): sc-11423. Immunoperoxidase staining of formalin fixed, paraffin-embedded human heart muscle tissue showing cytoplasmic staining of myocytes.
Download