Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Transcription Regulators » HDAC Antibodies » HDAC3 Antibody (H-99): sc-11417

HDAC3 Antibody (H-99): sc-11417

 |  Datasheet

(Based on data analysis)

  • HDAC3 Antibody (H-99) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 330-428 of HDAC3 of human origin
  • recommended for detection of HDAC3 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • TransCruz reagent for ChIP application, sc-11417 X, 200 µg/0.1 ml
  • See 74 citations for HDAC3 Antibody (H-99)
 
Full-length HDAC3 protein sequence with immunogen highlighted:
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

See additional HDAC Antibodies including HDAC, HDAC1, HDAC2, HDAC3, HDAC4, HDAC5, HDAC6, HDAC7, HDAC8, HDAC9, HDAC10 and HDAC11.

Also see HDAC3 Inhibitors for functional analysis of cellular responses to HDAC3.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
HDAC3 Antibody (H-99) sc-11417 200 µg/ml $279
HDAC3 Antibody (H-99) X sc-11417 X 200 µg/0.1 ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HDAC3 siRNA (h) sc-35538 10 µM $258
HDAC3 siRNA (m) sc-35539 10 µM $258
HDAC3 (h)-PR sc-35538-PR 10 µM, 20 µl $23
HDAC3 (m)-PR sc-35539-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HDAC3 shRNA Plasmid (h) sc-35538-SH 20 µg $520
HDAC3 shRNA Plasmid (m) sc-35539-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HDAC3 shRNA (h) Lentiviral Particles sc-35538-V 200 µl $625
HDAC3 shRNA (m) Lentiviral Particles sc-35539-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
C32 nuclear extract sc-2136 250 µg/0.05 ml $143
Jurkat nuclear extract sc-2132 250 µg/0.05 ml $143
K-562 nuclear extract sc-2130 250 µg/0.05 ml $143
A-431 nuclear extract sc-2122 250 µg/0.05 ml $143
NIH/3T3 nuclear extract sc-2138 250 µg/0.05 ml $143
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human HDAC3 8841 5q31.3 NM_003883 O15379
 605166
Mouse Hdac3 15183 18 B3 O88895
 N/A
 

In the intact cell, DNA closely associates with histones and other nuclear proteins to form chromatin. The remodeling of chromatin is believed to be a critical component of transcriptional regulation and a major source of this remodeling is brought about by the acetylation of nucleosomal histones. Acetylation of lysine residues in the amino-terminal tail domain of histone results in an allosteric change in the nucleosomal conformation and an increased accessibility to transcription factors by DNA. Conversely, the deacetylation of histones is associated with transcriptional silencing. Several mammalian proteins have been identified as nuclear histone acetylases, including GCN5, PCAF (p300/CBP-associated factor), p300/CBP and the TFIID subunit TAF II p250. Mammalian HDAC1 (also designated HD1), HDAC2 (also designated RPD3) and HDAC3, all of which are related to the yeast transcriptional factor Rpd3p, have been identified as histone deacetylases.

HDAC3 Antibody (H-99) Product Citations
See how others have used HDAC3 Antibody (H-99) and or HDAC3 Antibody (H-99) conjugates.


74 total citations
Loading citations.
 
HDAC3 Antibody (H-99) Data
Click on image to enlarge
sc-11417
HDAC3 (H-99): sc-11417. Western blot analysis of HDAC3 expression in Jurkat nuclear extract.
sc-11417
ChIP analysis of p52 promoter occupancy in murine p19 cells in response to activation by estradiol (E2). Antibodies tested include ERα (MC-20): sc-542, ERα (H-184): sc-7207, CBP (A-22): sc-369, CBP (C-1): sc-7300, p/CIP (F2): sc-5305, p/CIP (M-397): sc-9119, RIP140 (H-300): sc-8997 and HDAC3 (N-19): sc-11417. Data kindly provided by M.G. Rosenfeld and reproduced with permission from Perissi et al., Cell 2004, 116: 511-526.
sc-11417
ChIP analysis of cofactor occupancy dynamics on the KAI1 promoter in 293 cells in response to IL-1β treatment. Antibodies tested include NFκB p50 (C-19): sc-1190, NFκB p50 (E-10): sc-8414, NFκB p50 (H-119): sc-7178, NFκB p65 (C-20): sc-372, NFκB p65 (A): sc-109, NFκB p65 (H-286): sc-7151, HDAC3 (H-99): sc-11417, HDAC3 (N-19): sc-8138, Bcl-3 (C-14): sc-185, Bcl-3 (H-146): sc-13038. Data kindly provided by M.G. Rosenfeld and reproduced with permission from Baek et al., Cell 2002, 110: 55-67.
sc-11417
HDAC3 (H-99): sc-11417. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear localization.
sc-11417
HDAC3 (H-99): sc-11417. Western blot analysis of HDAC3 expression in HeLa nuclear extract.
sc-11417
HDAC3 (H-99): sc-11417. Immunoperoxidase staining of formalin fixed, paraffin-embedded human urinary bladder tissue showing nuclear and cytoplasmic staining of urothelial cells.
Download
Datasheets
Get Adobe Acrobat Reader