Welcome to Santa Cruz Biotechnology!

Ly-GDI Antibody (FL-201): sc-11359

 |  Datasheet

(Based on data analysis)

  • Ly-GDI Antibody (FL-201) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-201 of Ly-GDI of human origin
  • recommended for detection of Ly-GDI and, to a lesser extent, Rho GDIα and Rho GDIγ of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 2 citations for Ly-GDI Antibody (FL-201)
 
Full-length Ly-GDI protein sequence with immunogen highlighted:
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWT

See additional Ly-GDI Antibodies.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Ly-GDI Antibody (FL-201) sc-11359 200 µg/ml $279
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BJAB Whole Cell Lysate sc-2207 500 µg/200 µl $104
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
U-937 Cell Lysate sc-2239 500 µg/200 µl $104
WEHI-3 Cell Lysate sc-3815 500 µg/200 µl $104
Ly-GDI (m): 293T Lysate sc-121444 100 µg/200 µl $205
HEL 92.1.7 Cell Lysate sc-2270 500 µg/200 µl $104
Ramos Cell Lysate sc-2216 500 µg/200 µl $104
NAMALWA Cell Lysate sc-2234 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ARHGDIB 397 12p12.3 NM_001175 P52566
602843
Mouse Arhgdib 11857 6 G1 Q61599
N/A
 


The Ras superfamily of small GTP-binding proteins are critical mediators of diverse cell signaling pathways, including those leading to proliferation, cytoskeletal organization and secretion. The counter-conversion of the active GTP-bound form of these proteins to their inactive GDP-bound form is influenced by two types of regulatory proteins: those that alter the intrinsic GTPase activity of the GTP-binding proteins and those that alter the rate of GDP/GTP exchange. Guanine nucleotide-releasing factors (GRFs) increase the GDP dissociation rate, while GDP-dissociation inhibitors (GDIs) decrease the dissociation rate. The Rho GDI subfamily is composed of Rho GDIå, Ly-GDI (also known as Rho GDI∫ and previously known as GDI/D4) and Rho GDI©. The Rho GDI proteins interact with and have varying affinities for several Ras-like GTP binding proteins, including Rho A, Rho B, Rac and Cdc42. Ly-GDI is expressed only in hematopoietic cells, predominantly in B and T lymphocyte cell lines.

Ly-GDI Antibody (FL-201) Product Citations
See how others have used Ly-GDI Antibody (FL-201) and or Ly-GDI Antibody (FL-201) conjugates.


2 total citations
Loading citations.
 
Ly-GDI Antibody (FL-201) Data
Click on image to enlarge
Ly-GDI (FL-201): sc-11359. Western blot analysis of Ly-GDI expression in BJAB whole cell lysates.
Ly-GDI (FL-201): sc-11359. Immunofluorescence staining of methanol-fixed BJAB cells showing cytoplasmic localization.
Ly-GDI (FL-201): sc-11359. Immunoperoxidase staining of formalin fixed, paraffin-embedded human bone marrow tissue showing cytoplasmic staining of bone marrow poietic cells (low and high magnification). Kindly provided by The Swedish Human Protein Atlas (HPA) program.
Ly-GDI (FL-201): sc-11359. Western blot analysis of Ly-GDI expression in non-transfected 293T: sc-117752 (A), mouse Ly-GDI transfected 293T: sc-121444 (B) and U-937 (C) whole cell lysates.
Download